DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCA3;1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_199122.1 Gene:CYCA3;1 / 834324 AraportID:AT5G43080 Length:355 Species:Arabidopsis thaliana


Alignment Length:321 Identity:115/321 - (35%)
Similarity:173/321 - (53%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMD 308
            |.:.:|:.:.|.::|:                   |.||.:.....|.|.:: |||.....|...
plant    46 NIKKSRKATTKQKKKS-------------------VSIPTIETLNSDIDTRS-DDPQMCGPYVTS 90

  Fly   309 IFNYLKVREAEF-PIADYMPR-QIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCR 371
            ||.||:..|.:. |:.||:.: |..:|:.||.:||||:|||.|.::|..:||||||..:|.:|..
plant    91 IFEYLRQLEVKSRPLVDYIEKIQKDVTSNMRGVLVDWLVEVAEEYKLLSDTLYLAVSYIDRFLSL 155

  Fly   372 EVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPL 436
            :.:||::|||||..:..||.||:|..||.::||.||.|..|...|:|:||.:.|..::::||.|.
plant   156 KTVNKQRLQLLGVTSMLIASKYEEITPPNVDDFCYITDNTYTKQEIVKMEADILLALQFELGNPT 220

  Fly   437 SYRFLRRYARCAK--VPMPTLT---LARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQ 496
            |..||||:.|.|:  ..|..|.   |..|:.|||::||.::.|..|.:|::|:|:| |....|.|
plant   221 SNTFLRRFTRVAQEDFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSTVAASAVFLA-RFIIRPKQ 284

  Fly   497 LDKQTWTSTLIYYTGYQLADFAEIVTAL-NAGLHRKPRATIKTIRNKYSHKIFHEVAKVPL 556
               ..|...|..||.|:..|..|.|..: :..|.||..| ::.||.||....|..||.:|:
plant   285 ---HPWNVMLEEYTRYKAGDLKECVAMIHDLYLSRKCGA-LEAIREKYKQHKFKCVATMPV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 54/126 (43%)
Cyclin_C 435..555 CDD:281044 45/125 (36%)
CYCA3;1NP_199122.1 Cyclin_N 91..217 CDD:278560 54/125 (43%)
Cyclin_C 219..342 CDD:281044 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.