DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYC3B

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_568248.2 Gene:CYC3B / 831001 AraportID:AT5G11300 Length:436 Species:Arabidopsis thaliana


Alignment Length:405 Identity:122/405 - (30%)
Similarity:191/405 - (47%) Gaps:63/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAAR------R 250
            |.:|||    .|.....|. |.:..|.:.|...:..|.|         |..||.:|.|      :
plant    41 VSIPPT----KPSFKQQKR-RAVLKDVSNTSADIIYSEL---------RKGGNIKANRKCLKEPK 91

  Fly   251 RSAK----------LQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEE-----------------V 288
            ::||          :...||:......|:....|.:|.|.:....:|                 |
plant    92 KAAKEGANSAMDILVDMHTEKSKLAEDLSKIRMAEAQDVSLSNFKDEEITEQQEDGSGVMELLQV 156

  Fly   289 EDFDRKNWDDPFQVSHYAMDIFNYLKVRE-AEFPIADYMPR-QIHLTTWMRTLLVDWMVEVQETF 351
            .|.| .|.:||...|.||.||::.:.|.| .:.|:|:||.. |..:...||.:|:||:|||.:.:
plant   157 VDID-SNVEDPQCCSLYAADIYDNIHVAELQQRPLANYMELVQRDIDPDMRKILIDWLVEVSDDY 220

  Fly   352 ELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDE 416
            :|..:||||.|.::|.:|....|.:::|||||.:...||.||:|...|.:|:|.:|....|...|
plant   221 KLVPDTLYLTVNLIDRFLSNSYIERQRLQLLGVSCMLIASKYEELSAPGVEEFCFITANTYTRPE 285

  Fly   417 LVRMERETLRVIKYDLGIPLSYRFLRRYARCA----KVPMPTLT-LARYILELSLMDYANISFSD 476
            ::.||.:.|..:.:.|.:|.:..||||:.:.|    |||...|. ||.|:.||:|::|:.:.|..
plant   286 VLSMEIQILNFVHFRLSVPTTKTFLRRFIKAAQASYKVPFIELEYLANYLAELTLVEYSFLRFLP 350

  Fly   477 SQMASAALFMALRMHGGPGQLDK--QTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTI 539
            |.:|::|:|:|      ...||:  ..|..||.:||.|::|:....|.|:..........|:...
plant   351 SLIAASAVFLA------RWTLDQTDHPWNPTLQHYTRYEVAELKNTVLAMEDLQLNTSGCTLAAT 409

  Fly   540 RNKYSHKIFHEVAKV 554
            |.||:...|..|||:
plant   410 REKYNQPKFKSVAKL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/126 (36%)
Cyclin_C 435..555 CDD:281044 42/127 (33%)
CYC3BNP_568248.2 COG5024 4..418 CDD:227357 118/397 (30%)
Cyclin_N 175..302 CDD:365896 45/126 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.