DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCB1;1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_195465.1 Gene:CYCB1;1 / 829904 AraportID:AT4G37490 Length:428 Species:Arabidopsis thaliana


Alignment Length:422 Identity:119/422 - (28%)
Similarity:197/422 - (46%) Gaps:77/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LEEALARPKPRPKAVPAAKKTVLGEVQLPAMPNPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDF 218
            :|:.|.:|..:..|||..|| |.|:                        |:|.   .|..||:| 
plant    68 VEDNLKKPVVKRNAVPKPKK-VAGK------------------------PKVV---DVIEISSD- 103

  Fly   219 NKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPP 283
             ..|:...::|.|..::........:...||.::|...:|.::                      
plant   104 -SDEELGLVAAREKKATKKKATTYTSVLTARSKAACGLEKKQK---------------------- 145

  Fly   284 VPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQ 348
              |::.|.|..:.::......|..||:::.|..|:|:...|||..|..:...||.:||:|:::|.
plant   146 --EKIVDIDSADVENDLAAVEYVEDIYSFYKSVESEWRPRDYMASQPDINEKMRLILVEWLIDVH 208

  Fly   349 ETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYN 413
            ..||||.||.||.|.|:|.:|..:.:.:::|||:|.:|..::.||:|..||.:||.:.|.|.||:
plant   209 VRFELNPETFYLTVNILDRFLSVKPVPRKELQLVGLSALLMSAKYEEIWPPQVEDLVDIADHAYS 273

  Fly   414 HDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDY-ANISFSDS 477
            |.:::.||:..|..:::.|.:|..|.||.|:.:.:........:..|:.||.:|.| ..|.||.|
plant   274 HKQILVMEKTILSTLEWYLTVPTHYVFLARFIKASIADEKMENMVHYLAELGVMHYDTMIMFSPS 338

  Fly   478 QMASAALFMA---LRMHGGPGQLDKQTWTSTLIYYTGY---QLADFAEIVTALNAGLHRKPRATI 536
            .:|::|::.|   ||        ....|||||.::|||   ||.|.|::: |......::..:..
plant   339 MVAASAIYAARSSLR--------QVPIWTSTLKHHTGYSETQLMDCAKLL-AYQQWKQQEEGSES 394

  Fly   537 KT---IRNKYSHKIFHEVAKVP----LLTNQE 561
            .|   :|.|||......||.:|    |||..|
plant   395 STKGALRKKYSKDERFAVALIPPAKALLTGTE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 47/124 (38%)
Cyclin_C 435..555 CDD:281044 39/129 (30%)
CYCB1;1NP_195465.1 COG5024 <129..406 CDD:227357 92/309 (30%)
Cyclin_N 168..293 CDD:365896 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.