DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCB1;3

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_187759.2 Gene:CYCB1;3 / 820325 AraportID:AT3G11520 Length:414 Species:Arabidopsis thaliana


Alignment Length:491 Identity:120/491 - (24%)
Similarity:216/491 - (43%) Gaps:121/491 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PIKNDKI--------KRSALGNLTNNVKIMTLHPAQDEEQSGVGKKPTAQQLQALMDAKKQENLS 123
            |::.|.|        .|.|||::.|...::.:       :.|...:|..:..:|.:    .||  
plant    11 PVRGDPIDLKNAAAKNRRALGDIGNVDSLIGV-------EGGKLNRPITRNFRAQL----LEN-- 62

  Fly   124 VNVFGASKMTTRASSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKTVLGEVQLPAMPNPM 188
                  :::...|:.|.        .:||.:.:       :.:.|.|.:|...|:.:.|:  .|:
plant    63 ------AQVAAAANKKA--------PILDGVTK-------KQEVVRAVQKKARGDKREPS--KPI 104

  Fly   189 QIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSA 253
            ::.|:.|.|:     :||..|.        ||.:.: |.|.|:                ||.::|
plant   105 EVIVISPDTN-----EVAKAKE--------NKKKVT-YSSVLD----------------ARSKAA 139

  Fly   254 KLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREA 318
                                            .:..|.|..:.::......|..|::.:.|....
plant   140 --------------------------------SKTLDIDYVDKENDLAAVEYVEDMYIFYKEVVN 172

  Fly   319 EFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLG 383
            |.....||..|..:...||::|:||:|||...|:|:.|||||.|.|:|.:|..:.:.:.:|||:|
plant   173 ESKPQMYMHTQPEIDEKMRSILIDWLVEVHVKFDLSPETLYLTVNIIDRFLSLKTVPRRELQLVG 237

  Fly   384 AAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCA 448
            .:|..||.||:|..||.:.|.:|:.|.:||..:::.||:..|..:::.|.:|..|.||.|:.:.:
plant   238 VSALLIASKYEEIWPPQVNDLVYVTDNSYNSRQILVMEKTILGNLEWYLTVPTQYVFLVRFIKAS 302

  Fly   449 KVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLDK-QTWTSTLIYYTGY 512
            ........|..::.||.||.:.::.|..|.:|::|::.|...      |:| .|||.||.::|||
plant   303 GSDQKLENLVHFLAELGLMHHDSLMFCPSMLAASAVYTARCC------LNKTPTWTDTLKFHTGY 361

  Fly   513 ---QLADFAEIVTALNAGLHRKP-RATIKTIRNKYS 544
               ||.|.::::    |.:|.|. .:.::.:..|||
plant   362 SESQLMDCSKLL----AFIHSKAGESKLRGVLKKYS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/124 (36%)
Cyclin_C 435..555 CDD:281044 34/115 (30%)
CYCB1;3NP_187759.2 Cyclin_N 162..287 CDD:278560 45/124 (36%)
Cyclin_C 289..406 CDD:281044 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.