DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCB1;4

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:282 Identity:98/282 - (34%)
Similarity:150/282 - (53%) Gaps:23/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 EEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQET 350
            :.|.|.|..:.::......|..|||.:.:..|.|..|.||:..|..:...||::|:||:|:|...
plant   111 DAVIDIDAVDANNELAAVEYVEDIFKFYRTVEEEGGIKDYIGSQPEINEKMRSILIDWLVDVHRK 175

  Fly   351 FELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHD 415
            |||..|||||.:.:||.:|...::::.:|||||..|..|||||:|...|.:.||:.|.|.|||..
plant   176 FELMPETLYLTINLVDRFLSLTMVHRRELQLLGLGAMLIACKYEEIWAPEVNDFVCISDNAYNRK 240

  Fly   416 ELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVP----MPTLTLARYILELSLMDYANISFSD 476
            :::.||:..|..:::.:.:|..|.||.||.:.| ||    |..|..  |:.||.||.|..:..:.
plant   241 QVLAMEKSILGQVEWYITVPTPYVFLARYVKAA-VPCDAEMEKLVF--YLAELGLMQYPIVVLNR 302

  Fly   477 SQMASAALFMALRMHGGPGQLDKQT--WTSTLIYYTGY---QLADFAEIVTAL-NAGLHRKPRAT 535
            ..|.:|:...|.|      |:.|:|  ||.||.::|||   ::.:.|:::..| ::....|..|.
plant   303 PSMLAASAVYAAR------QILKKTPFWTETLKHHTGYSEDEIMEHAKMLMKLRDSASESKLIAV 361

  Fly   536 IKTIRNKYSHKIFHEVAKVPLL 557
            .|    |||.....|||.:|.|
plant   362 FK----KYSVSENAEVALLPSL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 50/124 (40%)
Cyclin_C 435..555 CDD:281044 42/129 (33%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 54/143 (38%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215 42/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122362
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106469
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.