DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNP

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006723458.2 Gene:CCNP / 79935 HGNCID:25805 Length:397 Species:Homo sapiens


Alignment Length:276 Identity:78/276 - (28%)
Similarity:120/276 - (43%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 MRLSGNFEAARRRSAKLQQKTEQQPQPLLLTL-------------------PETAPSQVVPIPPV 284
            |.:.|..:.:..|...:.::...:|.||....                   |..:|.::...|.:
Human    69 MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGL 133

  Fly   285 PEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQE 349
            .|.:.....:.      ...||.|||..:.|... .|:. .:||.:  |..||.|:|||:|:|.|
Human   134 EEALSALGLQG------EREYAGDIFAEVMVCRV-LPLR-ALPRAV--TPEMRALVVDWLVQVHE 188

  Fly   350 TFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNH 414
            ...|..:||||||.::|.||....:...:|||||.|..|:|||.:|...|.......:...:::.
Human   189 YLGLAGDTLYLAVHLLDSYLSAGRVRLHRLQLLGVACLFVACKMEECVLPEPAFLCLLSADSFSR 253

  Fly   415 DELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQM 479
            .||:|.||..|..:.:.|..|.....|...|..|......:.||.|.|||||::.....:...:.
Human   254 AELLRAERRILSRLDFRLHHPGPLLCLGLLAALAGSSPQVMLLATYFLELSLLEAEAAGWEPGRR 318

  Fly   480 ASAALFMALRMHGGPG 495
            |:|||.:|.|:..|.|
Human   319 AAAALSLAHRLLDGAG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/124 (36%)
Cyclin_C 435..555 CDD:281044 20/61 (33%)
CCNPXP_006723458.2 Cyclin_N 171..271 CDD:278560 38/101 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.