DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNI2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001274181.1 Gene:CCNI2 / 645121 HGNCID:33869 Length:385 Species:Homo sapiens


Alignment Length:314 Identity:71/314 - (22%)
Similarity:111/314 - (35%) Gaps:96/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 ALARPKPRPKAVPAAKKTVLGEVQLPAMPNPMQIPVLLPPTHNLAAP-----------QVAAVKP 210
            |:..|..||.|  ..::|.||   :|..|:|.:.|  ||.::....|           ..:|..|
Human    18 AVQSPGGRPGA--GLEETALG---VPLPPSPGEAP--LPRSNRSRCPGTRQPGAASLHAASAAVP 75

  Fly   211 V--RRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPET 273
            |  ||.:....||.|::..:|                             .||.|:|        
Human    76 VRPRRGTAPAGKTADAVPAAA-----------------------------PEQAPRP-------- 103

  Fly   274 APSQVVPIPPVPEEVE-DFDRKNWDDPFQVSHYAMDIFNYLKVREAEF--------PIADYMPRQ 329
                 .|....|..:| |.|.:......|:   |.|       |||..        .|.|.... 
Human   104 -----APQSRKPRNLEGDLDERRLLCHLQL---AQD-------REARLWRGGKPQDEICDAFEE- 152

  Fly   330 IHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYD 394
                      :|.|::.:|.||..:..|..||:.|....|....:.::.|......:..:|.|.:
Human   153 ----------VVLWLLRLQNTFYFSQSTFNLALTIFGRLLISVKVKEKYLHCATITSLRLAAKVN 207

  Fly   395 ERQP--PLIEDFLYICDGAYNHDELVRMERETLRVIKYDL--GIPLSYRFLRRY 444
            |.:.  |.::||.......|:.:||:|||...|..:.:||  |.||.:..:.:|
Human   208 EEEEFIPQVKDFTKHYGSDYSPNELLRMELAILDRLHWDLYIGTPLDFLTIEKY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 32/136 (24%)
Cyclin_C 435..555 CDD:281044 3/10 (30%)
CCNI2NP_001274181.1 Cyclin_N <156..247 CDD:278560 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.