DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccnp

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001038424.1 Gene:ccnp / 561391 ZFINID:ZDB-GENE-030131-5453 Length:398 Species:Danio rerio


Alignment Length:258 Identity:82/258 - (31%)
Similarity:128/258 - (49%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 YAMDIFNYLKVRE--AEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDL 367
            ||.|||:.:...:  ...|.|| :|:....||  |.:||||:::|.|.|:.:.|||||.|.:::.
Zfish   133 YAWDIFSDMMRSQLLCTLPNAD-LPKPFTDTT--RAILVDWLIQVHEVFQFSEETLYLTVHLLNR 194

  Fly   368 YLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDL 432
            .|....::...|||||....|:|.|.:|...|.:.:..|:.:.||:..:|:||||..|..:|:||
Zfish   195 ALRLIKVSISGLQLLGVVCLFLAAKREECLLPEVSELCYLMENAYSKKQLLRMERRVLIGLKFDL 259

  Fly   433 GIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMA---LRMHGGP 494
            .......||...|..|:.....:.:|||:|||||::...:.:..:|:|.|||.:|   |:....|
Zfish   260 YHCPPLHFLLISASIARCSDKVVWMARYLLELSLLEGRCVVYLPAQLAGAALRLARKILQEAAAP 324

  Fly   495 GQLDKQTWTSTLIYYTGYQ--LADFAEIVTALNAGLH-RKPRAT-IKTIRNKYSHKIFHEVAK 553
            ..  :..|......:.|.:  |....:|:....|... |:.||| ||....:..|...|...|
Zfish   325 EA--EMAWCIASSIHIGSEAVLLSIMQIMAIAAARAQTRETRATFIKFSTVQTLHVSMHPALK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/126 (36%)
Cyclin_C 435..555 CDD:281044 34/126 (27%)
ccnpNP_001038424.1 Cyclin_N 136..259 CDD:278560 44/125 (35%)
Cyclin_C 264..384 CDD:281044 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.