DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccng2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_012817793.2 Gene:ccng2 / 549201 XenbaseID:XB-GENE-920883 Length:347 Species:Xenopus tropicalis


Alignment Length:322 Identity:64/322 - (19%)
Similarity:116/322 - (36%) Gaps:75/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 VSHYAMDIFNYLKVREAEFPI-ADYMPRQ-----IHLTT--------WMRTLLVDWMVEVQETFE 352
            :.|.:.:.|..||.......: :.|.||:     |..|.        .:|...|:.:..:...|.
 Frog     1 MDHTSNEAFKLLKQLNLHLELESKYQPREKGLILIESTAENDNSICPRLRNAKVEDLWSLTNFFG 65

  Fly   353 LNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDER--QPPLIEDFLYICDGAYNHD 415
            |..||..|||.|:|.:|....:..:.|..:|...|.:|.|..|.  ..|.:.|.:.|........
 Frog    66 LGMETFVLAVNILDRFLAIMKVKPKHLSCIGVCCFQLAAKVVEEDCNIPSVHDVIRISQCKCTVS 130

  Fly   416 ELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLA-----RYILELSLMD------Y 469
            ::.|||:.....:.::.....:..||..|        .|:.|.     :.:|.|..::      .
 Frog   131 DMNRMEKIISEKLHFEFKATTALTFLHLY--------HTVVLCHSSKRKEVLNLDKLEAQLKACN 187

  Fly   470 ANISFSDSQ---------------MASAALF-MALRM--HGGPGQLDKQTW----TSTLIYYTGY 512
            ..:.||.::               :.|..|| :|||:  |......|...|    :..|..|:..
 Frog   188 CRLIFSKAKPSVLALCLLTLEVETLKSLELFEIALRVQKHSKVNDEDMLYWRELVSKCLADYSSP 252

  Fly   513 QLA--DFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPLLTNQELFQGNLDLNES 572
            :..  |..::|..::       |.|.:.:.|.|     :.|.::|.:..    .|.::.:||
 Frog   253 ECCKPDHKKLVWTVS-------RRTAQNLHNSY-----YSVPELPTIPE----CGRINESES 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 32/140 (23%)
Cyclin_C 435..555 CDD:281044 27/154 (18%)
ccng2XP_012817793.2 CYCLIN_CCNG2 49..144 CDD:410287 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.