DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccne2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001016267.1 Gene:ccne2 / 549021 XenbaseID:XB-GENE-923043 Length:397 Species:Xenopus tropicalis


Alignment Length:344 Identity:83/344 - (24%)
Similarity:152/344 - (44%) Gaps:55/344 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SMRLSGNFEA---ARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIP----PVPEEVEDFDRKN 295
            |...|..||.   |:|.:.::|....:      :|.....|..::..|    .:..::..|.|..
 Frog    32 SEETSTTFECHQDAKRHNYEIQGCWSE------ITTGTVTPCILIETPHKEMSISTDISQFSRYR 90

  Fly   296 WDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIH----------LTTWMRTLLVDWMVEVQET 350
            :.:.| :|...:...::...::....:.....|.:|          |...||::|:||::||.|.
 Frog    91 FKNLF-ISRSPLPELSWGNSKDVWMKMISKESRYVHSSRLLQNHPTLNPDMRSILLDWLIEVSEV 154

  Fly   351 FELNHETLYLAVKIVDLY-LCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNH 414
            :.|:.||.|||....|.: |.:..:||..|||:|..|.|||.|.:|..||.:.:|.|:.|||.:.
 Frog   155 YTLHRETFYLAQDFFDRFMLTQTCVNKSMLQLIGVTALFIASKLEEIYPPKLHEFAYVTDGACSE 219

  Fly   415 DELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKV-PMPTLTLARY----------ILELSLMD 468
            |::::||...|:.:|::|....:..:|..|.:.:.: ..|.|.|.:|          :|:|.::.
 Frog   220 DDILQMELIMLKALKWELYPVTAIAWLNLYLQVSSLKDHPKLLLPQYSQEQFIHVVQLLDLCILH 284

  Fly   469 YANISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPR 533
            :.::.|....:|:|||:             ..|.|..:...||..:....|.|..:      .|.
 Frog   285 HTSLDFQYRILAAAALY-------------HFTSTEVVTKATGLDMESIGECVHWM------APF 330

  Fly   534 ATIKTIRNKYSHKIFHEVA 552
            |.:....:.:..|:|.:||
 Frog   331 ARVVKRSSPFKLKVFKKVA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 43/135 (32%)
Cyclin_C 435..555 CDD:281044 25/129 (19%)
ccne2NP_001016267.1 Cyclin_N 111..237 CDD:365896 43/125 (34%)
Cyclin_C 240..359 CDD:367282 25/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.