DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNJ

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_016871843.1 Gene:CCNJ / 54619 HGNCID:23434 Length:431 Species:Homo sapiens


Alignment Length:257 Identity:64/257 - (24%)
Similarity:108/257 - (42%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVE 346
            ||.|.|:|.    .|    .....|.||...|:.:|.:.|  .|..:...|:  :|....|.:..
Human    45 PPGPMELEG----QW----WRGQLAADIHQALRYKELKLP--SYKGQSPQLS--LRRYFADLIAI 97

  Fly   347 VQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQP--PLIEDFLYI-C 408
            |...|.|.....:|||.::||::.|..|:.::|.|:..:...:|.|::|::.  |.:|....: |
Human    98 VSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGC 162

  Fly   409 DGAYN----HDELVRMERETLRVIKYDLGIPLSYRFLRRYARCA----------------KVPMP 453
            ....|    ...|:.||...|...:::|.:|.:..|:..|...|                |..:.
Human   163 MTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLY 227

  Fly   454 TLTLARYILELSLMDYANISFSDSQMASAALF---MALRMHGGPGQLDKQTWTSTLIYYTGY 512
            ....|.|.||:||.|||.::::.|.:|:|.:.   :.||:        ..||.:.|...|.|
Human   228 MAKYADYFLEVSLQDYAFLNYAPSLVAAACVASSRIILRL--------SPTWPTRLHRLTAY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 32/131 (24%)
Cyclin_C 435..555 CDD:281044 24/97 (25%)
CCNJXP_016871843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.