DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccno

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006232009.1 Gene:Ccno / 499528 RGDID:1565217 Length:352 Species:Rattus norvegicus


Alignment Length:307 Identity:80/307 - (26%)
Similarity:126/307 - (41%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQ 257
            |..|......|::...:|:|.: |..:...||......|..||......|....|.|..|:.|  
  Rat    25 LRAPVKKSRRPRLRRKEPLRPL-NACSLPGDSGVCDLFESPSSSSDGADSPAVSAVRDCSSLL-- 86

  Fly   258 KTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPI 322
               ...|||...                 :::.|           ..|....:::.|.:|..|..
  Rat    87 ---SSAQPLTAL-----------------DLQTF-----------REYGQSCYDFRKAQENLFHP 120

  Fly   323 ADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAF 387
            .:.:.||..:|...|..|:.|:::|...|.|:.|:|.|.|..:|.:|....:..:..||||....
  Rat   121 RESLARQPQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTPVAADCFQLLGVTCL 185

  Fly   388 FIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKV-- 450
            .||||..|..||.::..|.:|.||::..:|..:|...|..:.:.||.|....||..:.. ::|  
  Rat   186 LIACKQVEVHPPRMKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGAPTINFFLEHFTH-SRVEA 249

  Fly   451 -------PMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRM 490
                   .:...||||.:.||||.|||..:::.|.:|...|.:|.||
  Rat   250 GQVEVTEALAAQTLARGVAELSLTDYAFTTYTPSLLAICCLALADRM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 36/124 (29%)
Cyclin_C 435..555 CDD:281044 21/65 (32%)
CcnoXP_006232009.1 Cyclin_N 108..231 CDD:278560 36/122 (30%)
Cyclin_C 233..>298 CDD:281044 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.