DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CycG

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster


Alignment Length:414 Identity:77/414 - (18%)
Similarity:145/414 - (35%) Gaps:131/414 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSAKLQ-QKTEQQPQPLLLTLPETAPS 276
            :::|..|:..:          ...|.||::.........:|.|: ||.|||.|     |.:.|.|
  Fly   157 KLANGINRNAE----------MPTDWMRIADEGRYGTPGAAGLEYQKYEQQQQ-----LEDLAES 206

  Fly   277 QVVPIPPVP----------EEVEDFDRKNWDDPFQVSHYAMD-IFNYLK---VREAEFPIADYMP 327
            :...:....          :::||          |:.....| ::..||   |.:.:|.....:|
  Fly   207 EAGAVGGASNNNGESSSSLKKLED----------QLHALTSDELYETLKEYDVLQDKFHTVLLLP 261

  Fly   328 RQIHL---------TTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLG 383
            ::...         :.::...|..|       :||..:.|:.|:.:||.:|.|..:..:.:..:.
  Fly   262 KESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMS 319

  Fly   384 AAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPL------SYRFLR 442
            .|:|.:|.|..:.:|...||.:.|........:|.||    ..||...||:.:      |..:||
  Fly   320 VASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERM----AGVIANKLGVQMGHAPITSVSYLR 380

  Fly   443 RYARCAKVPMPTLTLARYI--------------------LELSLMDYANISFSDSQMASAALFMA 487
            .|....:      .||:.|                    ||:.:.|......:.|.:|...:.:.
  Fly   381 IYYALFR------NLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLH 439

  Fly   488 LRMH-------GGPG---------------QLDKQTWT-------STLIYYTGYQLADFAE-IVT 522
            |..|       |.|.               ::..:.:|       ..|.:|.|...|.:.: :|.
  Fly   440 LDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPYKQRLVW 504

  Fly   523 ALNAGLHRKPRATIKTIR--NKYS 544
            .|::       .|::.:|  |::|
  Fly   505 KLSS-------RTLRVLRPINRFS 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 29/137 (21%)
Cyclin_C 435..555 CDD:281044 27/168 (16%)
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.