DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccne2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001002075.1 Gene:ccne2 / 415165 ZFINID:ZDB-GENE-030131-9689 Length:392 Species:Danio rerio


Alignment Length:343 Identity:85/343 - (24%)
Similarity:145/343 - (42%) Gaps:74/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RRSAK--LQQKTEQQPQ---------PLLLTLPETAPSQ-------------------VVPIPPV 284
            |||.:  ||::.|..||         .....:|..|..|                   ..|...|
Zfish     3 RRSTRNTLQERNENAPQQKSQRKRKGECNRRVPSAAKKQHYEIQNRCFEGDVSASVLIETPQKEV 67

  Fly   285 PEEVED------FDRKNW---DDPFQVSHYAMDIFNYLKVREAEFPIA---DYMPRQIHLTTWMR 337
            .:|..:      |..||.   ..|.....:|.....::|:...|....   .::.:...|...||
Zfish    68 QQETSNLSGFKRFRFKNLFVKPSPLPCLSWASSDDVWIKMLNKELKYVHDKSFIQQHSALQPKMR 132

  Fly   338 TLLVDWMVEVQETFELNHETLYLAVKIVDLY-LCREVINKEKLQLLGAAAFFIACKYDERQPPLI 401
            .:|:||::||.|.:.|:.||.|||..|.|.: |.::.|.|::|||:|..:.|||.|.:|..||.:
Zfish   133 AILLDWLMEVSEVYTLHRETFYLAQDIFDRFMLTQKDIGKDQLQLIGITSLFIASKIEEIYPPKL 197

  Fly   402 EDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARC------AKVPMPTLTLARY 460
            ::|.|:.|||.|.:|::..|...|:.:.:||.......:|:.|::.      |...:|..:...|
Zfish   198 QEFAYVTDGACNEEEILAKELVMLKALNWDLCPETVISWLKLYSQVDSLKDEANFLIPQFSQETY 262

  Fly   461 I-----LELSLMDYANISFSDSQMASAAL--FMALRM-HGGPGQLDKQTWTS------------- 504
            |     |:|.::|..::.:....:|:||.  |.:..: |    ::...||.|             
Zfish   263 IQITQLLDLCILDINSLDYQYGVLAAAAFCHFTSFELVH----KVSGLTWDSISNCVRWMNPFMR 323

  Fly   505 TLIYYTGYQLADFAEIVT 522
            |:..:...:|.||.::.|
Zfish   324 TVREWPRPELKDFKKVKT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 43/128 (34%)
Cyclin_C 435..555 CDD:281044 22/115 (19%)
ccne2NP_001002075.1 Cyclin_N 102..229 CDD:278560 43/126 (34%)
Cyclin_C 232..353 CDD:281044 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.