DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and LOC394448

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001182327.1 Gene:LOC394448 / 394448 -ID:- Length:390 Species:Xenopus tropicalis


Alignment Length:406 Identity:122/406 - (30%)
Similarity:196/406 - (48%) Gaps:57/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VPAAKKTVLG-EVQLPAMPNPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALE 231
            |.|||..|.| ...|..:.|...||...|...|..    .|||.||::::..|        .||.
 Frog    20 VVAAKAKVHGHRAPLEEISNRTVIPGRKPAIMNCK----VAVKAVRQVTSRAN--------VALR 72

  Fly   232 DVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNW 296
            ...:|..            ||        ::|.|:.:.:.................|:|.|.::.
 Frog    73 IKPTCGP------------RS--------EEPPPISMDISVKEEVLCQAFSKALNSVDDIDAEDS 117

  Fly   297 DDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIH---LTTWMRTLLVDWMVEVQETFELNHETL 358
            .:|...:.|..||:.||:..|.:..:   .||.:|   :...||.:||||:::|...|:|..|||
 Frog   118 FNPQLCTDYVKDIYTYLRQLEVQQAV---RPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETL 179

  Fly   359 YLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERE 423
            |:|:.|:|.:|..:.|::.||||:|..:.|||.||:|...|.|.||:||.|..|:..::..||..
 Frog   180 YMAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMM 244

  Fly   424 TLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMAL 488
            .|:.:.:|||.||...||||.::|........|||:|.:||:|:||..:.|..|.:|:|||.:..
 Frog   245 ILKELNFDLGRPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYDMVHFHPSAIAAAALCLTQ 309

  Fly   489 RMHGGPGQLDKQTWTSTLIYYTGYQLAD-------FAEIVTALNAGLHRKPRATIKTIRNKYSHK 546
            ::      |:..||.:||.:||||...|       .|:::..:|     :.:....:::||||..
 Frog   310 KV------LNIGTWDATLQFYTGYSQDDLILPMKHMAKVIVQVN-----QNQTKFLSVKNKYSSS 363

  Fly   547 IFHEVAKVPLLTNQEL 562
            ...:::.:|.|.::.|
 Frog   364 KLLKISTIPQLNSRVL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 49/127 (39%)
Cyclin_C 435..555 CDD:281044 38/126 (30%)
LOC394448NP_001182327.1 COG5024 <92..371 CDD:227357 94/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.