DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CycJ

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster


Alignment Length:357 Identity:76/357 - (21%)
Similarity:131/357 - (36%) Gaps:80/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 LQQKTEQQPQPLLL--TLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVRE 317
            ::||...:....::  .|.:|.|.         .:||...:.:|     ::.||.|||  |.:||
  Fly     1 MEQKVAAEQNIFVVDRKLKKTCPQ---------ADVERLAKTHW-----LTDYARDIF--LTMRE 49

  Fly   318 AEF---PIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKL 379
            .|.   |:. |:..|::    .|..::..:.......:|:...|:|||..:|.::....|..:||
  Fly    50 QELSRRPLF-YLSPQLN----ERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKL 109

  Fly   380 QLLGAAAFFIACKYDERQP--PLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLR 442
            .|:......||.:.:....  |...:...:...||...|...:||:.|..:.::|..|.:..|:.
  Fly   110 LLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVE 174

  Fly   443 RYARCAKVPMP-----------------TLTLARYI-----------LELSLMDYA-NIS-FSDS 477
            .:| |:.:...                 |....|||           |.|.:.||. .|| |::.
  Fly   175 LFA-CSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFAND 238

  Fly   478 --QMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIR 540
              .:.:||...|:|...|     .:.|:..|:..|.|..|:....:..|.              .
  Fly   239 LPSLLAAACIAAVRQVSG-----VRRWSEYLVGLTSYTEANVEPYMNVLT--------------D 284

  Fly   541 NKYSHKIFHEVAKVPLLTNQELFQGNLDLNES 572
            ..|.|.|..:.....:.|||.|...:....||
  Fly   285 YYYYHVIQTDYGSPSVQTNQSLASPDSGFEES 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 30/129 (23%)
Cyclin_C 435..555 CDD:281044 29/151 (19%)
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 30/128 (23%)
Cyclin_C <225..>286 CDD:281044 16/79 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.