DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CYCJ18

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001030944.1 Gene:CYCJ18 / 3768365 AraportID:AT2G01905 Length:234 Species:Arabidopsis thaliana


Alignment Length:261 Identity:51/261 - (19%)
Similarity:97/261 - (37%) Gaps:90/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 MRTLLVDWMVEVQETFELNHETLYLAVKI-VDLY---LCR------------EVINKEKLQLLGA 384
            :|..||:::::.....||.....|.|:.: .|.:   |.|            :.:|:..|||...
plant     8 LRRRLVEFLIQSTTLLELPPIVKYSALSLFFDRFRPNLVRFLQKKKAEHWLLQPLNESNLQLFVL 72

  Fly   385 AAFFIACKYD------------------ERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYD 431
            .:.:|:||..                  ..|..::.|||        ..|||     .|:|:|::
plant    73 ISIWISCKMHCTRGLSVHSLKSFGDKVITEQLFMVRDFL--------DAELV-----FLKVLKFE 124

  Fly   432 LGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQ 496
            :|                    ||.:|...||..|:.:..::....|:...|....:.:     .
plant   125 IG
--------------------TLNIAYTRLEDLLIQFKEVAKVGEQLNFEACMDMMDL-----L 164

  Fly   497 LDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTI-RNKYSHKIFHEVAKVPLLTNQ 560
            .:|:  .::|:|.:...||  |.|:.:          :.|.|: :.:|...|   :..|.::||:
plant   165 YEKE--DTSLLYQSSKSLA--ASILVS----------SYIITVPKQQYEFPI---LPWVKMVTNK 212

  Fly   561 E 561
            |
plant   213 E 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/130 (21%)
Cyclin_C 435..555 CDD:281044 19/120 (16%)
CYCJ18NP_001030944.1 CYCLIN <7..126 CDD:381775 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.