DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccnb2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_955462.1 Gene:ccnb2 / 368316 ZFINID:ZDB-GENE-030429-12 Length:386 Species:Danio rerio


Alignment Length:345 Identity:106/345 - (30%)
Similarity:167/345 - (48%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPP------VPEE--------- 287
            |::.:|.......:||::|.:               ||.....:||      :.||         
Zfish    52 SVKPTGRSAVVHPKSAQVQHE---------------APKPAATVPPAQADVSMKEEELCQAFSNS 101

  Fly   288 ---VEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQE 349
               |:|.|..:.|.|...|.|..||::||:..|.:..:.........:...||.|||||:::|..
Zfish   102 LFPVDDIDEGDADMPQLCSEYVKDIYSYLRRLEGQQSVRPRYMEGYDINGRMRALLVDWLIQVHS 166

  Fly   350 TFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNH 414
            .|:|..||||:.|.|:|.:|..:.:.:.||||:|..|..|||||:|...|::.||.||.|.|:..
Zfish   167 RFQLLQETLYMTVAILDRFLQVQPVTRRKLQLVGVTAMLIACKYEEMYVPMVGDFAYIADDAFTK 231

  Fly   415 DELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQM 479
            .::..||...|..:.:.||.||...||||.::.........|||:|.|||:|:||..:.::.|:.
Zfish   232 AQIREMEMLMLSGLNFKLGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYNPSET 296

  Fly   480 ASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLAD-------FAEIVTALNAGLHRKPRATIK 537
            |:|||.::..:      ||.|.|:||..:|:.|..|.       .|:.|..:|.||.:.     .
Zfish   297 AAAALCLSQLV------LDGQKWSSTQQHYSTYDEAHLKPIMQLIAKNVVMVNEGLSKH-----L 350

  Fly   538 TIRNKYSHKIFHEVAKVPLL 557
            |:|.||:.....:::.:|.|
Zfish   351 TVRKKYASSRLMKISLLPQL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 45/124 (36%)
Cyclin_C 435..555 CDD:281044 39/126 (31%)
ccnb2NP_955462.1 Cyclin_N 125..250 CDD:278560 45/124 (36%)
Cyclin_C 252..370 CDD:281044 40/128 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R194
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.