DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccnb2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001009470.1 Gene:Ccnb2 / 363088 RGDID:1308176 Length:398 Species:Rattus norvegicus


Alignment Length:407 Identity:123/407 - (30%)
Similarity:202/407 - (49%) Gaps:67/407 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LAAPQVAAVKPVRRISNDFN---KTEDSLYMSALEDVSSCDSMRLSGNFEAAR-RRSAKLQQKTE 260
            |..|.|::  .::.|....|   |:..::..:.||::         ||...|| .:.||..|.|:
  Rat     4 LRRPTVSS--DLKNIDTGVNPKAKSHVTVRRAVLEEI---------GNKVRARPAQVAKKPQNTK 57

  Fly   261 ------------QQPQPLLLTLP---ET-APSQVVPIP---PVPEE-------------VEDFDR 293
                        :||:|.....|   || ||...:|.|   .:.||             :||.|.
  Rat    58 VPVQPTKAINASKQPKPTASVKPVQMETLAPKDPLPAPEDVSMKEESLCQAFSDALLCKIEDIDN 122

  Fly   294 KNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETL 358
            ::.::|...|.|..||:.||:..||...|..:......:...||.:||||:|:|...|.|..|||
  Rat   123 EDGENPQLCSDYVKDIYQYLRQLEALQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETL 187

  Fly   359 YLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERE 423
            |:.:.|:|.:|..:.:.::||||:|..|..:|.||:|...|.||||:||.|.||...::..||..
  Rat   188 YMCIAIMDRFLQAQPVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETL 252

  Fly   424 TLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMAL 488
            .|:.:|::||.||...||||.::..:|.:...|||:|::||:|:||..:.:..||:|:||..::.
  Rat   253 ILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQ 317

  Fly   489 RMHG-GPGQLDKQTWTSTLIYYTGYQLADFAEI-------VTALNAGLHRKPRATIKTIRNKYSH 545
            ::.| |...|.:|       |||||..::..|:       |..:|..|.:     ...::|||:.
  Rat   318 KVLGQGKWNLKQQ-------YYTGYMESEILEVMQHMAKNVVKVNENLTK-----FIAVKNKYAS 370

  Fly   546 KIFHEVAKVPLLTNQEL 562
            ....:::.:|.|.::.:
  Rat   371 SRLLKISTIPQLNSRTI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 48/124 (39%)
Cyclin_C 435..555 CDD:281044 37/127 (29%)
Ccnb2NP_001009470.1 Cyclin_N 137..262 CDD:278560 48/124 (39%)
Cyclin_C 264..382 CDD:281044 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.