DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CycE

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster


Alignment Length:550 Identity:130/550 - (23%)
Similarity:204/550 - (37%) Gaps:166/550 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGALGAATRKG--LTRRAAATGNIDPNVENMQTRAKRKADHSPIKNDKIKRSALGNLTNNVKIMT 89
            |.|..|||..|  ..||.::..|.||.:......|||:.                      ::..
  Fly    99 LAASTAATSNGNKRKRRLSSDSNEDPELGFEPPSAKRQQ----------------------RLPA 141

  Fly    90 LHPAQDEEQSGVGKKPTAQQLQALMDAKKQENLSVNVFGASKMTTRASSKVEDSVENCHKVLDKL 154
            |:.::....|.|........:.::.....||.||:.           ||..||           |
  Fly   142 LYGSEQGNLSSVASSVYTSPVVSVDGQSTQELLSIR-----------SSPAED-----------L 184

  Fly   155 EEALARPKP-RPKAVPAAKKTVLGEVQLPAMPNPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDF 218
            .||...|.| .|.:.|:..:            ...|.||::    ..||.||.....|.:.:.|.
  Fly   185 SEAPHSPLPDSPDSPPSPDR------------GSKQTPVVV----RYAAEQVVTSTVVTQKTEDD 233

  Fly   219 NKTEDS----------------------LYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQ 261
            :..:||                      :|.|.:...||..|.:.:.|.|    |:..|.:..||
  Fly   234 DLLDDSCEDYSYDEDDEDDVEEEDDDVEIYSSTISPASSGCSQQQAVNGE----RTPGLPKHQEQ 294

  Fly   262 QPQPL--LLTLPETAPSQVV-------PIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVRE 317
            ...|:  |:....|..|..|       |:|.:.          |.:       |.|::..:..|:
  Fly   295 IHHPVSDLMINMRTPMSPAVENGLRQCPLPALA----------WAN-------AADVWRLMCHRD 342

  Fly   318 AEFPIADYMPRQIH-------LTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYL-CREVI 374
            .:    |...|.|.       |...||.:|:||::||.|.::|:.||.||||..:|.|| ....:
  Fly   343 EQ----DSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKV 403

  Fly   375 NKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYD-------- 431
            .|..|||:|....|:|.|.:|..||.|.:|.|:.|||....:::..|:..|:.:.:|        
  Fly   404 QKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITG 468

  Fly   432 -LGI----------PLSYRFLRRYARCAKVP----MPTLTLARYI-----LELSLMDYANISFSD 476
             ||:          |.|:..:.| .:.|:..    .|..:...::     |:|..:|....::|.
  Fly   469 WLGVYMQLNVNNRTPASFSQIGR-QKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSY 532

  Fly   477 SQMASAALF------MALRMHGGPGQLDKQ 500
            |.:|:||:.      ||||..|    ||.|
  Fly   533 SVLAAAAISHTFSREMALRCSG----LDWQ 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 44/141 (31%)
Cyclin_C 435..555 CDD:281044 20/80 (25%)
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 44/132 (33%)
Cyclin_C <517..>571 CDD:281044 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447488
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.