DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CycD

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster


Alignment Length:420 Identity:93/420 - (22%)
Similarity:164/420 - (39%) Gaps:90/420 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQ 264
            :::|  |.::....|.:.....|...:..|..:...|:...|...: |:...:||..::.|..|.
  Fly    27 MSSP--AIIRDQSSICSSLGDAESDSHPDAQNNAVVCNMKELVYIY-ASVDSAAKNPEQLEPPPP 88

  Fly   265 PLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHY--------------AMD------- 308
            |     |...|    |.|...:.::.:.|....:| ..||.              |.|       
  Fly    89 P-----PPPPP----PPPTATQSIQSYPRYISQEP-PTSHCQRLDERLTTTADPPATDNVNTAIG 143

  Fly   309 ---------IFNYLKVREAEFPIAD-YMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVK 363
                     :.|:|||.|....|.| |...|..:|..||.::.:||:||........|.:.||:.
  Fly   144 DPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALN 208

  Fly   364 IVDLYLCREVINKEKLQLLGAAAFFIACKYDERQP---PLIEDFLYI-CDGAYNHDELVRMERET 424
            .:|.:|..:.:.|.:||:|.||...:|.|.  |:|   .|..|.|.: .|.:...|:|::.|...
  Fly   209 YMDRFLSSKSVRKTQLQILAAACLLLASKL--REPSCRALSVDLLVVYTDNSIYKDDLIKWELYV 271

  Fly   425 LRVIKYDLG--IPLSYRFLRRYARCAKVPM-----PTLTL------ARYILELSLMDYANISFSD 476
            |..:.:||.  .||.:..|    ...::|:     |.:.:      |:..:.|:..::....||.
  Fly   272 LSRLGWDLSSVTPLDFLEL----LMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSA 332

  Fly   477 SQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRN 541
            |.:|::::  |..|:|....|           .:|:.|.....::|.|.:....:.|..:     
  Fly   333 STIAASSI--AASMNGLKWHL-----------RSGHNLHFLLSLMTDLTSVEQAQVRDCM----- 379

  Fly   542 KYSHKIFHEVAKVPLLTNQELFQGNLDLNE 571
            .:...||.|.::     |.|.|..|:|..|
  Fly   380 LHMEDIFKEHSR-----NLEPFLVNIDPKE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 41/145 (28%)
Cyclin_C 435..555 CDD:281044 23/130 (18%)
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 40/126 (32%)
Cyclin_C 282..>392 CDD:281044 23/136 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.