DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccnjl

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001032862.2 Gene:Ccnjl / 303059 RGDID:1561384 Length:387 Species:Rattus norvegicus


Alignment Length:317 Identity:64/317 - (20%)
Similarity:105/317 - (33%) Gaps:87/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 DDPFQVSHYAMDIFNYLKVREAEFP-----------------IADYMPRQIHLTTWMRTLLVDWM 344
            |:|:.....|.|:...|:.:|.:.|                 |...:.|..||....|       
  Rat     2 DEPWWEGRVASDVHCTLREKELKLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSAR------- 59

  Fly   345 VEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQP--PLIED---- 403
                      |..:||....:|.|   .|...::|..:..:...:|.|:::|:.  |.::.    
  Rat    60 ----------HLAIYLLDHFMDQY---NVTTSKQLYTVAVSCLLLASKFEDREDRVPKLDQINST 111

  Fly   404 -FLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYA---------RCAKVPMPTL--- 455
             .|...:.:....||:..|...|....:||.:|....||..|.         .|...|...|   
  Rat   112 RILSSHNFSLTKKELLTTELLLLEAFSWDLCLPTPAHFLDYYLLASISQKDHHCHTWPTTCLRKT 176

  Fly   456 -----TLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLDKQT---WTSTLIYYTGY 512
                 ..|.|.||::|.|:....|..|.:|:|.:        |..::..|.   ||..|...:.|
  Rat   177 KECLKEYAHYFLEVTLQDHIFYKFQPSVVAAACV--------GASRICLQLSPYWTRDLQRVSNY 233

  Fly   513 QLADFAEIVTALNAGLHR--KPRATIKTIRNKYSHKIFHEVAKVPLLTN---QELFQ 564
            .|...:..:..|......  |....:|:          ..:|.||..::   |.|||
  Rat   234 SLEHLSTCIEILLVAYDNVLKDAVAVKS----------QALAMVPSSSSAPTQVLFQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 26/148 (18%)
Cyclin_C 435..555 CDD:281044 28/141 (20%)
CcnjlNP_001032862.2 CYCLIN_CCNJ-like_rpt1 32..120 CDD:410231 17/107 (16%)
CYCLIN_CCNJ-like_rpt2 144..245 CDD:410232 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.