DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccne1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_571070.1 Gene:ccne1 / 30188 ZFINID:ZDB-GENE-980526-168 Length:410 Species:Danio rerio


Alignment Length:398 Identity:90/398 - (22%)
Similarity:159/398 - (39%) Gaps:88/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 APQVAAVKPVRRISNDFNKTEDSLYM-SALEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQP 265
            ||:..:|:|.:|      |.:.:::: ...|:|:           |..|::....|....     
Zfish    18 APKTTSVRPRKR------KADVAIHLQDPDEEVT-----------EMTRKKQCASQACWN----- 60

  Fly   266 LLLTLPE---TAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADY-- 325
                 |:   |:|.:.:|.|...||...|....:      :.||.:.......|....|...:  
Zfish    61 -----PDTGYTSPCRRIPTPDEVEEPVAFGSVGF------TQYASESIFITPTRSTPLPALCWAS 114

  Fly   326 ---------------------MPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYL 369
                                 |.|..:|...||.:|:||::||.|.::|:.||.||.....|.::
Zfish   115 KDEVWNNLLGKDKLYLRDTRVMERHPNLQPKMRAILLDWLMEVCEVYKLHRETFYLGQDYFDRFM 179

  Fly   370 C-REVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYD-- 431
            . :|.:.|..|||:|.:..|||.|.:|..||.:..|.|:.|||...|:::.||...::.:.:.  
Zfish   180 ATQENVLKTTLQLIGISCLFIAAKMEEIYPPKVHQFAYVTDGACTEDDILSMEIIIMKELNWSLS 244

  Fly   432 -------LGIPLSYRFLRRYAR--CAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMA 487
                   |.|.:...:|:..|.  .|:.|..|......:|:|.::|..::.||.|.:|::|||  
Zfish   245 PLTPVAWLNIYMQMAYLKETAEVLTAQYPQATFVQIAELLDLCILDVRSLEFSYSLLAASALF-- 307

  Fly   488 LRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIV---TALNAGLHRKPRATIKTIRNKYSHKIFH 549
               |....:|        :|..:|.:..|..|.|   ......:.....:.:||.:...:..:.:
Zfish   308 ---HFSSLEL--------VIKVSGLKWCDLEECVRWMVPFAMSIREAGSSALKTFKGIAADDMHN 361

  Fly   550 EVAKVPLL 557
            ....||.|
Zfish   362 IQTHVPYL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 40/157 (25%)
Cyclin_C 435..555 CDD:281044 24/124 (19%)
ccne1NP_571070.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 5/18 (28%)
Cyclin_N 117..244 CDD:278560 38/126 (30%)
Cyclin_C 247..368 CDD:281044 27/133 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.