DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccni

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001099468.1 Gene:Ccni / 289500 RGDID:1309209 Length:377 Species:Rattus norvegicus


Alignment Length:136 Identity:35/136 - (25%)
Similarity:60/136 - (44%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 MPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIA 390
            :|...:::...|..::.|:.:::..|.|..||..||..::|.:|.....:.:.|..:..:.||:|
  Rat    34 IPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLNCIAISCFFLA 98

  Fly   391 CK---YDERQP---PLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAK 449
            .|   .||:.|   .|..|....|..:    |::||||..|..:.:||.......||..:...|.
  Rat    99 AKTVEEDEKIPVLKVLARDSFCGCSSS----EILRMERIILDKLNWDLHTATPLDFLHIFHAIAV 159

  Fly   450 VPMPTL 455
            ...|.|
  Rat   160 STRPQL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 29/112 (26%)
Cyclin_C 435..555 CDD:281044 5/21 (24%)
CcniNP_001099468.1 Cyclin_N 38..142 CDD:278560 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.