DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccng2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_998337.1 Gene:ccng2 / 266794 ZFINID:ZDB-GENE-021016-1 Length:330 Species:Danio rerio


Alignment Length:341 Identity:54/341 - (15%)
Similarity:111/341 - (32%) Gaps:107/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 MDIFNYLKVREAEFPI-ADYMPRQIHL-------------TTWMRTLLVDWMVEVQETFELNHET 357
            |:.|..:|..::...: ..|:|::..|             :...|...|:.:..:...|..:.:|
Zfish     1 MEAFKLMKELKSNLDLEVQYLPKETGLRLIESTQENSNGVSAKCRDARVEDLWSLTNFFGYSTQT 65

  Fly   358 LYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHD------- 415
            ..|||.::|.:|....:..:.|..:......||.:..|.:          |:.:.:|:       
Zfish    66 FVLAVNLLDRFLAMMKVQPKYLACISIGCLHIAVRVTEGE----------CNVSSSHELIRISQC 120

  Fly   416 -----ELVRMERETLRVIKYDLGIPLSYRFLRRYARCA--------------------------- 448
                 :|.|||:.....:.:......:..||..|...|                           
Zfish   121 KFTVSDLSRMEKIISEKLNFQFKAVTALTFLHLYHAIALSHTSNRKDVLNLDKLEAQLKACLCRI 185

  Fly   449 ---KVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRM--HGGPGQLDKQTWTSTLIY 508
               |.....|.|:..:||:..:..|::           |.:|.|:  |....:.|...|...:  
Zfish   186 VFSKAKPSVLALSLLMLEIEALQSADL-----------LEIAHRIQTHLKISKADLGRWRGLV-- 237

  Fly   509 YTGYQLADFAEIVTALNAGLHRK-----PRATIKTIRNKYSHKIFHEVAKVPLL----------- 557
              |..:.|::....|...  |:|     .|.|.:.:.:.|.     .:.::|.:           
Zfish   238 --GQCIRDYSSPECAKPD--HKKLVWIVSRRTAQNLHSSYC-----SIPELPTIPEGVWDESESE 293

  Fly   558 -TNQELFQGNLDLNES 572
             ::::|..|...|:.|
Zfish   294 DSSEDLSSGEESLSSS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 24/150 (16%)
Cyclin_C 435..555 CDD:281044 24/156 (15%)
ccng2NP_998337.1 CYCLIN <59..140 CDD:294043 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.