DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and cig1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_588110.2 Gene:cig1 / 2539433 PomBaseID:SPCC4E9.02 Length:415 Species:Schizosaccharomyces pombe


Alignment Length:369 Identity:115/369 - (31%)
Similarity:179/369 - (48%) Gaps:59/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ISNDFNKT--EDSLYMSALE-----------DVSSCDSMRLSGNFEA-------ARRRSAKLQQK 258
            ||:....|  ||..|...:|           .:...|.....|:|:|       .:.|...:.:.
pombe    65 ISSSTGDTFEEDFAYQDKVEIEERSIRSTPKSIGDDDLENREGSFDAPEGILTHGKHRLPTIPEW 129

  Fly   259 TEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEF-PI 322
            |::.    |..|.|.|..  :...|.||::|       .||..|..|..:||:|::..|.:. |.
pombe   130 TKED----LAALSEAAAR--LQANPSPEDIE-------TDPSMVPDYDPEIFHYMQSLERKLAPP 181

  Fly   323 ADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAF 387
            .:||..|..:....|.:||||:|:||..|.|..|||:|||.::|.:|..:|::.:|:||:|.:|.
pombe   182 PNYMSVQQEIDWVTRHMLVDWIVQVQIHFRLLPETLFLAVNLIDRFLSIKVVSLQKVQLVGLSAL 246

  Fly   388 FIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPM 452
            .|||||:|..||.|.:|.::..|.:..||::|.||..|.::.:|:..|....||||.:|......
pombe   247 LIACKYEEIHPPSIYNFAHVVQGIFTVDEIIRAERYMLMLLDFDISWPGPMSFLRRISRADSYDH 311

  Fly   453 PTLTLARYILELSLMDY----ANISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGY- 512
            ....||:|:.|::|||.    |:|||    :|:.|.:::::|   .|.||   ||...:||:|| 
pombe   312 DIRMLAKYLQEVTLMDEIFIGAHISF----IAATAYYLSMQM---LGHLD---WTPCHVYYSGYT 366

  Fly   513 --QLADFAEIV--TALNAGLHRKPRATIKTIRNKYSHKIFHEVA 552
              ||...|.|:  ..::|..|.      ..|..|||......|:
pombe   367 ARQLKPCAIIIMECLVDAPNHH------NAIYRKYSENRMKRVS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 50/125 (40%)
Cyclin_C 435..555 CDD:281044 40/127 (31%)
cig1NP_588110.2 COG5024 1..414 CDD:227357 115/369 (31%)
Cyclin_N 166..292 CDD:278560 50/125 (40%)
Cyclin_C 294..408 CDD:281044 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3040
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47403
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R194
SonicParanoid 1 1.000 - - X94
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.