powered by:
Protein Alignment CycB3 and T07F10.5
DIOPT Version :9
Sequence 1: | NP_001262934.1 |
Gene: | CycB3 / 42971 |
FlyBaseID: | FBgn0015625 |
Length: | 575 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506221.3 |
Gene: | T07F10.5 / 188237 |
WormBaseID: | WBGene00011591 |
Length: | 116 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 9/41 - (21%) |
Similarity: | 19/41 - (46%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 297 DDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMR 337
||...:..:.:..|.::..:.....:..|..::|:||..||
Worm 23 DDDHSMERFLIGKFEFVVAKPTPSWLGSYFAKRINLTKKMR 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CycB3 | NP_001262934.1 |
Cyclin_N |
308..433 |
CDD:278560 |
7/30 (23%) |
Cyclin_C |
435..555 |
CDD:281044 |
|
T07F10.5 | NP_506221.3 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5024 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D993640at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.