DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and F08F1.9

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_509425.1 Gene:F08F1.9 / 184192 WormBaseID:WBGene00017259 Length:130 Species:Caenorhabditis elegans


Alignment Length:116 Identity:36/116 - (31%)
Similarity:60/116 - (51%) Gaps:1/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 MRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPL 400
            |||:|:||..:....:...:|.::|||.:||..|....|||.:.||:|..:..||.||:|..||:
 Worm     1 MRTILIDWFSDAVREYIFRNEAVHLAVSLVDRALPMFNINKMRFQLVGITSMRIAVKYEEIFPPI 65

  Fly   401 IEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVP 451
            :.:..:..|||..:.: ||:.|.....|...:.:.......::.|.|.:.|
 Worm    66 LSNTRHSFDGAILYWK-VRLHRRNAHTILDRIMLCTENELYKKDAECCQTP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 33/96 (34%)
Cyclin_C 435..555 CDD:281044 3/17 (18%)
F08F1.9NP_509425.1 Cyclin_N <1..>68 CDD:365896 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.