DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and cyb-2.1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_502047.1 Gene:cyb-2.1 / 177994 WormBaseID:WBGene00000866 Length:317 Species:Caenorhabditis elegans


Alignment Length:307 Identity:78/307 - (25%)
Similarity:145/307 - (47%) Gaps:35/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 RKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHET 357
            |.|.::.......|.||:|||...|.::.:.|......::.:.||.:||||:::|...|.|..||
 Worm    19 RTNLEEVLNCIAMAEDIYNYLVHHEKKYVLDDSFINGGNVNSKMRRILVDWLIQVHLRFHLTPET 83

  Fly   358 LYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMER 422
            |:|.:.::|..:.:.:::|.:.||||.||.|:|.|:::...|.|.::..|.|..::..:::.||:
 Worm    84 LHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFEDIYLPDILEYEMITDNTFSKKQIMAMEQ 148

  Fly   423 ETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLT-----------------LARYILELSLMDYA 470
            ..|..:.:||..|.|..|||..::       |||                 :::.:.||:|:|..
 Worm   149 TILNALNFDLSCPSSLVFLRCISK-------TLTENDVNPIDKEAFYYVHNISKCLGELALLDSV 206

  Fly   471 NISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPR-A 534
            ..:...|.:|||::.:.|.:....| ::.:|..|.:....|....|..:.:..|....::..| .
 Worm   207 MSTVPRSHVASASMIITLNVITVDG-INPKTAASMIRKQLGASKQDIYDAIALLAQVAYKNFRHQ 270

  Fly   535 TIKTIRNKYSHKIFHEVAKVPLLTNQELFQ------GNLDLNESNLS 575
            .:..||.||....|   .:|..|...|:.:      .|::.:|:..|
 Worm   271 KLCAIREKYQSSKF---GRVSYLMTDEILEKIHRMGRNVEASEAETS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 39/124 (31%)
Cyclin_C 435..555 CDD:281044 29/137 (21%)
cyb-2.1NP_502047.1 COG5024 <32..300 CDD:227357 73/278 (26%)
Cyclin_N 34..159 CDD:365896 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R194
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.