DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and cyb-2.2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_491297.1 Gene:cyb-2.2 / 171993 WormBaseID:WBGene00000867 Length:339 Species:Caenorhabditis elegans


Alignment Length:294 Identity:77/294 - (26%)
Similarity:142/294 - (48%) Gaps:35/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 AMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLC 370
            |.||:|||...|.::.:.|......::.:.||.:||||:|:|...|.|..|||:|.:.::|..:.
 Worm    54 AEDIYNYLVHHEKKYVLDDSFINGGNVNSKMRRILVDWLVQVHLRFHLTPETLHLTIFVLDRIIV 118

  Fly   371 REVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIP 435
            :.:::|.:.||||.||.|:|.|:::...|.|.::..|.:..::..:::.||:..|..:.:||..|
 Worm   119 KNIVSKAEFQLLGVAALFVASKFEDIYLPDILEYELITENTFSKKQILAMEQTILNALNFDLSCP 183

  Fly   436 LSYRFLRRYARCAKVPMPTLT-----------------LARYILELSLMDYANISFSDSQMASAA 483
            .|..|||..::       |||                 :::.:.||:|:|....:...|.:|||:
 Worm   184 SSLVFLRYISK-------TLTENDVNPIDKETFYYVHNISKCLGELALLDSVMSTVPRSHVASAS 241

  Fly   484 LFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPR-ATIKTIRNKYSHKI 547
            :.:.|.:....| ::.:|..|.:....|....|..:.::.|....::..| ..:..||.||....
 Worm   242 MIITLNIISVDG-INPKTAASMIRKQFGASKQDIYDAISLLAQVAYKNFRHQKLCAIREKYQSSK 305

  Fly   548 FHEVAKVPLLTNQELFQ------GNLDLNESNLS 575
            |   .:|..|...|:.:      .||:.:|:..|
 Worm   306 F---GRVSYLMTDEILEKIHRMGRNLEASEAETS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 39/124 (31%)
Cyclin_C 435..555 CDD:281044 29/137 (21%)
cyb-2.2NP_491297.1 COG5024 <54..322 CDD:227357 73/278 (26%)
Cyclin_N 56..181 CDD:365896 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3978
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R194
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.