DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccng1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_021336635.1 Gene:ccng1 / 171473 ZFINID:ZDB-GENE-020322-1 Length:313 Species:Danio rerio


Alignment Length:224 Identity:46/224 - (20%)
Similarity:94/224 - (41%) Gaps:28/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 PIPPVPEEVEDFDRKNWDDPF---------QVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTW 335
            |:|.:.::|.:....    ||         |.|.|...:.....:..|:       ...:.:|..
Zfish    11 PLPEMIDQVTETGAL----PFTVQLKSLLDQESRYQPKLCGLRVIESAQ-------DNGLRMTVK 64

  Fly   336 MRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACK--YDERQP 398
            :|...|..::.:...|....||...||.::|.:|....|..:.|..:|...|:||.|  .:|:..
Zfish    65 LRDYQVRELLSLTRFFGFCAETFSFAVNLLDRFLAVMKIQPKHLSCVGLCCFYIAVKTSEEEKNV 129

  Fly   399 PLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILE 463
            ||..|.:.|....:...:::|||:..|..:.:.:..|.:..|||.:.  :.:.....|.::.||.
Zfish   130 PLASDLIRISQNRFTVHDMMRMEKIILEKLNWKVKAPTALHFLRFFH--SHIQEKVDTESKKILN 192

  Fly   464 LSLMD----YANISFSDSQMASAALFMAL 488
            :..::    ..:.||:.:::..:.|.::|
Zfish   193 IERLEAQLKACHCSFTFTKLKPSLLALSL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/126 (21%)
Cyclin_C 435..555 CDD:281044 11/58 (19%)
ccng1XP_021336635.1 Cyclin_N 31..163 CDD:306612 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.