DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccng2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_031661.3 Gene:Ccng2 / 12452 MGIID:1095734 Length:344 Species:Mus musculus


Alignment Length:284 Identity:57/284 - (20%)
Similarity:107/284 - (37%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 LTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDER 396
            |.:.:|...|:.:..:...|....||..|||.|:|.:|....:..:.|..:|...|.:|.:..|.
Mouse    51 LCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEE 115

  Fly   397 Q---PPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLA 458
            :   || ..|.:.|........::.|||:.....:.|:|....:..||..|   ..:.....:..
Mouse   116 EGDVPP-THDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLY---HAIVFCHTSER 176

  Fly   459 RYILELSLMD------YANISFSDSQMASAALFMALRMHGGPGQLDKQTWTST------LIYYTG 511
            :.||.|..::      ...:.||.::.:..||.:.        .|:.:|..|.      |:....
Mouse   177 KEILSLDKLEAQLKACNCRVVFSKARPSVLALCLL--------NLEIETIKSVELLEILLLVKKH 233

  Fly   512 YQLAD-----FAEIVTALNAGLHRKPR------------ATIKTIRNKYSHKIFHEVAKVPLLTN 559
            .:|:|     :.|:|:...|. :..||            .:.:|.:|  .|..::.|.::|.:..
Mouse   234 LKLSDTEFFYWRELVSKCLAE-YSSPRCCKPDLKKLVWIVSRRTAQN--LHSSYYSVPELPTIPE 295

  Fly   560 QELFQG--------NLDLNESNLS 575
            ...|.|        ::...|.:||
Mouse   296 GGCFDGSESEDSGEDMSCGEESLS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 25/103 (24%)
Cyclin_C 435..555 CDD:281044 25/148 (17%)
Ccng2NP_031661.3 Cyclin_N <74..153 CDD:278560 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.