DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccng1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_033961.1 Gene:Ccng1 / 12450 MGIID:102890 Length:294 Species:Mus musculus


Alignment Length:250 Identity:55/250 - (22%)
Similarity:106/250 - (42%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 IHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACK-- 392
            :.:|..:|...|..::.:.:.|..:.||..|||.::|.:|.:..:..:.|..:|.:.|::|.|  
Mouse    44 LRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKAT 108

  Fly   393 YDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYARCAKVPMP---- 453
            .:||..||..|.:.|....:...:|:|||:..|..:.:.:....:::||:.|.......:|    
Mouse   109 EEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKV
KATTAFQFLQLYYSLVHDTLPFERR 173

  Fly   454 -TLTLARYILELSLMDYANISFSDSQMASAAL-FMALRMHG--------GPGQLDKQTWTSTLIY 508
             .|...|...:|... :..|.||.::.:..|| .:||.:..        |...:.|.:..|    
Mouse   174 NDLNFERLEAQLKAC-HCRIIFSKAKPSVLALSILALEIQALKYVELTEGVECIQKHSKIS---- 233

  Fly   509 YTGYQLADFAEIV----TALNAGLHRKPRA----------TIKTIRNKYSHKIFH 549
              |..|..:.|:|    |..::....||..          |.:.:::.| ::|.|
Mouse   234 --GRDLTFWQELVSKCLTEYSSNKCSKPNGQKLKWIVSGRTARQLKHSY-YRITH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 27/104 (26%)
Cyclin_C 435..555 CDD:281044 27/142 (19%)
Ccng1NP_033961.1 Cyclin_N 16..148 CDD:278560 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.