DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccne2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:435 Identity:98/435 - (22%)
Similarity:172/435 - (39%) Gaps:129/435 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 AMPNPMQIPVLLPPTHNLAAPQVAAVKPVRRISNDFNKTEDSLYMSALEDVSSCDSMRLSGN--- 244
            |.||....|         ...|:...|. |:.:.|..|.::.:......::.:|....|||.   
Mouse    14 AQPNQPDSP---------QETQIIQAKK-RKTAQDVKKRKEEITKKHQYEIRNCWPPVLSGGISP 68

  Fly   245 ---FEAARRR--SAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPV----PEEV-----EDFDRKN 295
               .|...:.  ::...:.|..:.:.|.:.     ||   |:|.:    .:||     :..:|..
Mouse    69 CIIIETPHKEIGTSDFSRFTNYRFKNLFIN-----PS---PLPDLSWACSQEVWQNMLQKENRYV 125

  Fly   296 WDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYL 360
            .|..|||.|                  :|..|:       ||::|:||::||.|.:.|:.||.||
Mouse   126 HDKHFQVLH------------------SDLEPQ-------MRSILLDWLLEVCEVYTLHRETFYL 165

  Fly   361 AVKIVDLY-LCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERET 424
            |....|.: |.::.:||..|||:|..:.|||.|.:|...|.:::|.|:.|||.:..::::||...
Mouse   166 AQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNI 230

  Fly   425 LRVIKYDLGIPLSYRFLRRYARCAKV-PMPTLTLARY----------ILELSLMDYANISFSDSQ 478
            |:.:|::|.......:|..:.:...| .:|.:.|.:|          :|:|.::...::.|....
Mouse   231 LKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRI 295

  Fly   479 MASAAL-----------------------------FMALRMHGGPGQL---------DK---QTW 502
            :|:|||                             |:::.....|.:|         |:   ||.
Mouse   296 LAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTH 360

  Fly   503 TSTL----------IYYTGYQLADFAEIVTALNAGLHRKPRATIK 537
            |:.|          ||..|.||:      ...|.|:...|::|.|
Mouse   361 TNYLALLNEVNYVNIYRKGGQLS------PVCNGGIMTPPKSTEK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 39/125 (31%)
Cyclin_C 435..555 CDD:281044 30/165 (18%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 8/36 (22%)
Cyclin_N 112..239 CDD:365896 47/151 (31%)
Cyclin_C 241..361 CDD:367282 18/119 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.