DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and Ccne1

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_031659.2 Gene:Ccne1 / 12447 MGIID:88316 Length:408 Species:Mus musculus


Alignment Length:413 Identity:100/413 - (24%)
Similarity:165/413 - (39%) Gaps:111/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 KTEDSLYMSALEDVSSCD-SMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPP 283
            :..||...|.:::....| |:|       :|:|.|.:.... |.|...:..:.:|..|:....| 
Mouse     3 RERDSTDHSNMKEEGGSDLSVR-------SRKRKANVAVFL-QDPDEEIAKIDKTVKSEDSSQP- 58

  Fly   284 VPEEVEDFDRKNWDDPFQVSHYAMDIFNYLKV------REAEFPIADYMPRQIH--------LTT 334
                        |||    :...:|..:::..      .|.|:|...:.||:|.        :..
Mouse    59 ------------WDD----NSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLN 107

  Fly   335 W---------------------------------MRTLLVDWMVEVQETFELNHETLYLAVKIVD 366
            |                                 ||.:|:||::||.|.::|:.||.|||....|
Mouse   108 WGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFD 172

  Fly   367 LYLC-REVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKY 430
            .|:. :..|.|..|||:|.:|.|||.|.:|..||.:..|.|:.|||.:.||::.||...::.:|:
Mouse   173 RYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKW 237

  Fly   431 DLGIPLS-YRFLRRYARCAKV-----------PMPTLTLARYILELSLMDYANISFSDSQMASAA 483
            .|. ||: ..:|..|.:.|.|           |.........:|:|.::|...:.|....:|::|
Mouse   238 RLS-PLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASA 301

  Fly   484 LFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIF 548
            |:     |....:|.::.        :|||..|..:.|..:      .|.|.:  ||...|.|:.
Mouse   302 LY-----HFSSLELMQKV--------SGYQWCDIEKCVKWM------VPFAMV--IREMGSSKLK 345

  Fly   549 HEVAKVPL--LTNQELFQGNLDL 569
            | ...||:  ..|.:....:|||
Mouse   346 H-FRGVPMEDSHNIQTHTNSLDL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 48/172 (28%)
Cyclin_C 435..555 CDD:281044 28/131 (21%)
Ccne1NP_031659.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 6/30 (20%)
Cyclin_N 113..240 CDD:278560 40/126 (32%)
Cyclin_C 243..362 CDD:281044 29/140 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.