DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and LOC105948063

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_012824177.1 Gene:LOC105948063 / 105948063 -ID:- Length:301 Species:Xenopus tropicalis


Alignment Length:290 Identity:65/290 - (22%)
Similarity:119/290 - (41%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LEDVSSCDSMRLSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEVEDFDRK 294
            ||:.|.....|.:.:.||:.::     .|.:.|                ||..||      :.:.
 Frog    11 LEETSKGGEGRSTDSSEASNKK-----LKYDHQ----------------VPRGPV------YLKD 48

  Fly   295 NWDDPFQV-------SHYAMDIFNYLKVREAEFPIADYMPRQ--IHLTTWMRTLLVDWMVEVQET 350
            .|:...::       |.:..:.:.:.|.:|..|...:::.:|  |..|:|  :.:...|:.|...
 Frog    49 PWNSFGKIGKALKMFSEFGENGYQFDKSKEESFTPVNFLDKQPNISETSW--SAVTTQMINVHRK 111

  Fly   351 FELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHD 415
            :..:.|||.|::.::..:|....|....|:.:||...::|||..|:..|..::||    .|:.:.
 Frog   112 YGFDFETLCLSINMLQRFLDCTPIEIANLKAVGATCLYVACKVVEKHQPEKQNFL----NAFTNT 172

  Fly   416 ELV-----RMERETLRVIKYDLGIP-----LSYRFLRRYARCAKV------PMPTLTLARYILEL 464
            .|.     .:|:..|:.::|.|..|     |.|..|:|.:|....      .:.||..|:.:..|
 Frog   173 GLTPTLLYGLEKLILQQLQYRLWAPTINSFLEYYSLQRMSRNKNSHAHLTREVKTLLAAKAVAAL 237

  Fly   465 SLMDYANISFSDSQMASAALFMA-LRMHGG 493
            |:..|...:...|.||.:.|..| |.|..|
 Frog   238 SMTSYKAQAHKPSVMAQSCLKAADLLMQEG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 30/131 (23%)
Cyclin_C 435..555 CDD:281044 20/71 (28%)
LOC105948063XP_012824177.1 Cyclin_N 71..194 CDD:365896 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.