DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and CCNO

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_066970.3 Gene:CCNO / 10309 HGNCID:18576 Length:350 Species:Homo sapiens


Alignment Length:277 Identity:76/277 - (27%)
Similarity:120/277 - (43%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NFEAARRRSAKLQQKTEQQPQPL-------------LLTLPET------APSQV---VPIPPVPE 286
            |..|..::|.:.:.:.:|...||             |...|.:      :||..   .|:|...:
Human    24 NLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDGAESPSAARGGSPLPGPAQ 88

  Fly   287 EVEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETF 351
            .|...|.:.:.|      |....:.:.|.:|:.|...:.:.||..:|...|..|:.|::.|...|
Human    89 PVAQLDLQTFRD------YGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWLIPVHRQF 147

  Fly   352 ELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDE 416
            .|:.|:|.|.|..:|.:|....:..:..||||..:..||||..|..||.::..|.:|.||::..:
Human   148 GLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSRQQ 212

  Fly   417 LVRMERETLRVIKYDLGIPLSYRFLRRYARC--------AKVPMPTLTLARYILELSLMDYANIS 473
            |..:|...|..:.:.||.|....||..:...        |...:....|||.:.||||.|||..|
Human   213 LCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTS 277

  Fly   474 FSDSQMASAALFMALRM 490
            :|.|.:|...|.:|.||
Human   278 YSPSLLAICCLALADRM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 36/124 (29%)
Cyclin_C 435..555 CDD:281044 22/64 (34%)
CCNONP_066970.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 12/64 (19%)
Cyclin_N 108..229 CDD:278560 36/120 (30%)
Cyclin_C 231..>296 CDD:281044 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3978
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.