DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and XB940382

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_002943185.2 Gene:XB940382 / 100492352 XenbaseID:XB-GENE-940383 Length:436 Species:Xenopus tropicalis


Alignment Length:320 Identity:77/320 - (24%)
Similarity:123/320 - (38%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 PVPEEVEDFDRKNWDDPFQV-SHYAMDIFNYLKVREAEFPIADYMPRQ--IHLTTWMRTLLVDWM 344
            ||||........|..|..|. ..|..:.:.|.|..|.::.:.:::..|  |:.|:|  ..:...|
 Frog    50 PVPEGEPWNTLTNLADALQTFREYGEECYLYKKGLEGDYQMENFLENQKEINPTSW--NYITTLM 112

  Fly   345 VEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPL-IEDFLYIC 408
            :.|.....|:.:||.|.:..::.|:.....:.:.|..:||...::|.|..|.:.|| .:.||.:.
 Frog   113 INVHRYLRLDFQTLCLGINFLERYVSCTPTDPDTLTRVGATCLYMAYKVAELRYPLPPKHFLPLF 177

  Fly   409 DGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYA----------------RCAKVPMPTLTL 457
            |......|:..:||..||.:.:.||:|....||..::                |.||    :||.
 Frog   178 DYRMTPAEMRHLERTILRKLLFRLGVPTIDFFLEHFSLLRLTNQEECSPAQLTRAAK----SLTA 238

  Fly   458 ARYILELSLMDYANI-SFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIY------------Y 509
            ||.|..|.|..:.:. ....|.||...|.:|          ||       ||            |
 Frog   239 ARGIAALCLNQHHDFYMHKPSLMALCCLNVA----------DK-------IYCYNNPVKVAPTDY 286

  Fly   510 TGYQLADFAE----IVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPLLTNQELFQG 565
            ..:|:.:..|    :|:..:..||.........|...::|......| .|  |||.|.:|
 Frog   287 PEHQIEECIEKICHLVSIGHYFLHPLLPGVYPEIFPSFNHPTTRPAA-TP--TNQHLPEG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 30/127 (24%)
Cyclin_C 435..555 CDD:281044 31/152 (20%)
XB940382XP_002943185.2 COG5024 <92..336 CDD:227357 61/269 (23%)
Cyclin_N 92..202 CDD:365896 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.