DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and XB997834

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_017951851.1 Gene:XB997834 / 100487861 XenbaseID:XB-GENE-997835 Length:327 Species:Xenopus tropicalis


Alignment Length:266 Identity:67/266 - (25%)
Similarity:110/266 - (41%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NFEAARRRSA--KLQQKTEQQP-----QPLLLTLPETAPSQVVPIPPVPEEVEDFDRKNWDDPFQ 301
            ||...|:|.|  .:|:.:...|     :|         ..:..|.|||.:....|.  |..|..|
 Frog     3 NFFNKRKREAIPDIQEGSHHNPWCYWKKP---------KYECSPAPPVQDPWNTFG--NMADTLQ 56

  Fly   302 V-SHYAMDIFNYLKVREAEFPIADYMPRQ--IHLTTWMRTLLVDWMVEVQETFELNHETLYLAVK 363
            . ..|....:.:.|..|.:|...:::..|  |:...|...::.  |:.....|:|:.|||.|||.
 Frog    57 TFMDYGETCYMFKKSLEEDFIPHNFLANQSDINAKCWKDVVIT--MIIAHRAFKLDFETLCLAVN 119

  Fly   364 IVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYI-CDGAYNHDELVRMERETLRV 427
            .::.:|....:....|:::|....::|||..|:..|.|..||.: |:..:....:..:||..||.
 Frog   120 YLERFLACTPLKAANLKVMGGTCLYLACKVMEKSLPKINQFLALFCEDGFTAPLMSYLERLVLRR 184

  Fly   428 IKYDLGIPLSYRFLRRYA--RCAKVPMP---------TLTLARYILELSLMDYANISFSDSQMAS 481
            :.:.||.|....||..::  |.:....|         .||.||.|..||:..|...::..|.:|.
 Frog   185 LCFRLGAPTIEYFLEHFSLRRVSNKECPAAKINRAANALTAARGIAALSMTKYGFPAYPPSLLAQ 249

  Fly   482 AALFMA 487
            ..|..|
 Frog   250 CCLTAA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 31/127 (24%)
Cyclin_C 435..555 CDD:281044 17/64 (27%)
XB997834XP_017951851.1 Cyclin_N 66..190 CDD:365896 31/125 (25%)
Cyclin_C 192..>268 CDD:367282 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.