DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccni2

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001096463.1 Gene:ccni2 / 100125081 XenbaseID:XB-GENE-5874358 Length:358 Species:Xenopus tropicalis


Alignment Length:261 Identity:53/261 - (20%)
Similarity:97/261 - (37%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 VEDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPIADY-----MPRQIHLTTWMRTLLVDWMVEV 347
            :.||.|           ..:.:.|.|::.:.::.:..:     ....|.||.:.:.:|  |:.||
 Frog     6 LSDFQR-----------LMISLENSLQLEDTKWKVPAFEGGTLKGTDISLTHYEQAIL--WIDEV 57

  Fly   348 QETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQP--PLIEDFLY---- 406
            ...|....||..|||.|::..|....:..:.|:.:.....|:|.|.:|...  |.::....    
 Frog    58 TLRFRFYPETFGLAVSILNRILASVKVQVKYLRCITVTCLFLAAKTNEEDEIIPSVKRLAVQSGC 122

  Fly   407 ICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRRYAR------------CAKV-PMPTLTLA 458
            :|..|    |::||||..|..:::||.......||..:..            |.:: |...|.|.
 Frog   123 MCSPA----EILRMERIVLDKLQWDLCTATPVDFLNTFHAMLMSNLPHLFHDCLRMNPSSHLALL 183

  Fly   459 RYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTA 523
            ...|:..:..:..:.|..|.:|...:.:         :|:|.|             ||:...:|.
 Frog   184 TRQLQQCMACHQLVQFRGSTLALVIITL---------ELEKLT-------------ADWFPAITE 226

  Fly   524 L 524
            |
 Frog   227 L 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 32/135 (24%)
Cyclin_C 435..555 CDD:281044 17/103 (17%)
ccni2NP_001096463.1 Cyclin_N 44..145 CDD:278560 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.