DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccnj

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001128285.1 Gene:ccnj / 100038087 XenbaseID:XB-GENE-485597 Length:385 Species:Xenopus tropicalis


Alignment Length:233 Identity:53/233 - (22%)
Similarity:98/233 - (42%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 AMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLC 370
            |.||...|:.:|.:.|.......|::|    |....|.:..|...|:|.....:|||.::||::.
 Frog    13 AADIHQTLRYKELKLPSYKGQSPQLNL----RRYFADLIAIVSNRFKLCPTARHLAVYLLDLFMD 73

  Fly   371 REVINKEKLQLLGAAAFFIACKYDERQP--PLIEDFLYI-CDGAYN----HDELVRMERETLRVI 428
            |..|:.::|.::..:...:|.|:::::.  |.::....: |....|    ...|:.||...|...
 Frog    74 RYDISIQQLHIVALSCLLLASKFEDKEDRVPKLDQLNSLGCMTNMNLVLTKQNLLHMELLLLETF 138

  Fly   429 KYDLGIPLSYRFLRRYARCA----------------KVPMPTLTLARYILELSLMDYANISFSDS 477
            :::|.:|....|:..|...|                |..:.....|.|.||:||.|:..:::..|
 Frog   139 EWNLCLPTPAHFIEYYLSIAVHDTDLHDGWPMICLEKTKIYMAKYADYFLEVSLQDHMFLNYVPS 203

  Fly   478 QMAS---AALFMALRMHGGPGQLDKQTWTSTLIYYTGY 512
            .:|:   ||..:.||:        ..:|.:.|...|.|
 Frog   204 LVAAACVAASRIILRL--------SPSWPTRLHRLTVY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 29/131 (22%)
Cyclin_C 435..555 CDD:281044 22/97 (23%)
ccnjNP_001128285.1 Cyclin_N 15..>109 CDD:365896 23/97 (24%)
Cyclin_C 145..>251 CDD:367282 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.