DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB3 and ccnjl

DIOPT Version :9

Sequence 1:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001296774.1 Gene:ccnjl / 100001904 ZFINID:ZDB-GENE-030131-9888 Length:407 Species:Danio rerio


Alignment Length:314 Identity:65/314 - (20%)
Similarity:125/314 - (39%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 AMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLC 370
            |.||...|:::|.:.|.......||    .||....|.:..:...::|.....:|||.::||::.
Zfish    16 AADIHQALRIKELKLPTYQAHSPQI----GMRRYFADLLAVLSNRYQLCPTARHLAVYLLDLFMD 76

  Fly   371 REVINKEKLQLLGAAAFFIACKYDERQP--PLIED-----FLYICDGAYNHDELVRMERETLRVI 428
            ...:...:|.::..:...:|.|::|::.  |.:|.     |:...:...|..:|::||...|...
Zfish    77 HYDVAVRQLYVIALSCLLLASKFEEKEDRVPKLEQLNTLGFMCSLNLTLNKRDLIKMELLLLETF 141

  Fly   429 KYDLGIPLSYRFLRRYARCAKV--------PMPTLTLAR--------YILELSLMDYANISFSDS 477
            .::|.:|....|:..|...|..        |:.:|:..:        |.||:||.|:|.:||..|
Zfish   142 GWNLCMPTPAHFIDYYLHAAVQEGDLHNGWPLSSLSKTKAFMDKYTHYFLEVSLQDHAFLSFRPS 206

  Fly   478 QMASAALF---MALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTAL--------------- 524
            |:|:|.:.   :.|::        ..:||:.|...|||......:.:..:               
Zfish   207 QVAAACIAASRICLQI--------SPSWTTVLHLLTGYSWDHLTQCIQLMLLAHDNDVKEANKSK 263

  Fly   525 ---NAG-----------------LHRKPRATIKTIRNKYSHKIFHEVAKVPLLT 558
               :||                 |||:|.::        |.::..:.:..|.|:
Zfish   264 SSPSAGQSLQPQAHVPPSTAAPSLHRQPTSS--------SQQLLLQASSYPQLS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 28/131 (21%)
Cyclin_C 435..555 CDD:281044 33/173 (19%)
ccnjlNP_001296774.1 Cyclin_N 18..146 CDD:278560 28/131 (21%)
Cyclin_C 148..>254 CDD:281044 26/113 (23%)
STAT6_C 255..>344 CDD:291272 9/63 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.