DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elal and col-92

DIOPT Version :9

Sequence 1:NP_001262933.1 Gene:Elal / 42970 FlyBaseID:FBgn0013949 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_499408.1 Gene:col-92 / 176528 WormBaseID:WBGene00000667 Length:304 Species:Caenorhabditis elegans


Alignment Length:271 Identity:89/271 - (32%)
Similarity:103/271 - (38%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FAALALIQIASGQASQFSR------DESQEDQKTEFNLASTLTGGITSSRHRQRANLNSQLYPGL 67
            ||.:..|:.:...||:|:|      ||:.|            ||...|    |..:.:....|| 
 Worm    61 FAEVNHIRGSPKNASRFARQAGYGTDEAVE------------TGNTGS----QGGSCSGCCLPG- 108

  Fly    68 GQLGSGYAGATGSIDDAHGHEQGGSGVRVASTNSVVFPGNQSPNPALTITGGHQIPAYPPPGFPG 132
               .:|.||..|.  .......|.:|:          |||....||....     |..|||..|.
 Worm   109 ---AAGPAGTPGK--PGRPGRPGAAGL----------PGNPGRPPAQPCE-----PITPPPCKPC 153

  Fly   133 QQAPVPYPAAGGSSG--GSSSSGGYQS-AGAVSPPGYPVAGAVPAQYPVGVP--PQQPVGAGAPG 192
            .|.|...|.|.|..|  |:....|..| |||..|.|           |.|.|  |..|..|||||
 Worm   154 PQGPAGAPGAPGPQGDAGAPGQAGQGSGAGAPGPAG-----------PKGAPGAPGNPGQAGAPG 207

  Fly   193 YFPGTGAY----PGYPYPGVYLPQYPAYPQPAQFPAYGVLPGAVAQPGVPGVAGVPGAPGVAGVP 253
            . ||:.|.    ||  .||...||.|  |.||..|.....||....||..|.:|.||.||..|.|
 Worm   208 Q-PGSDAQSESSPG--APGQAGPQGP--PGPAGSPGAPGGPGQAGAPGPKGPSGAPGQPGADGNP 267

  Fly   254 GAAGQAPATSG 264
            ||.|| |..||
 Worm   268 GAPGQ-PGQSG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ElalNP_001262933.1 PHA03247 <105..282 CDD:223021 67/169 (40%)
col-92NP_499408.1 Col_cuticle_N 12..64 CDD:198156 2/2 (100%)
PRK07764 <107..281 CDD:236090 75/209 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28608
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.