DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KMT2A and CG4565

DIOPT Version :9

Sequence 1:XP_011541131.1 Gene:KMT2A / 4297 HGNCID:7132 Length:4005 Species:Homo sapiens
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:286 Identity:75/286 - (26%)
Similarity:116/286 - (40%) Gaps:81/286 - (28%)


- Green bases have known domain annotations that are detailed below.


Human  3761 DAVVFLIEQL----SGAKHCRNYKFRFHKPEEANEPPLNP--------------HGSA------R 3801
            |.:.:::|.:    .|:|     :|:| ..:|.|...|||              ||..      .
  Fly    16 DGLDYILESVLMPSDGSK-----EFKF-LADEYNSVLLNPCHCKGACENSEVCAHGGQYEFTEDG 74

Human  3802 AEVHLRKSAFDMFNFLASKHRQPPEYNP----NDEEEEEVQLKSARRATSMDLPMPMRFRHLKKT 3862
            :|:.||.||                 ||    ||      ..|..|...|..|......:||:  
  Fly    75 SELILRNSA-----------------NPVIECND------MCKCCRNTCSNRLVYSGPRKHLE-- 114

Human  3863 SKEAVGVYRSPIHG-RGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDS 3926
                  ::.||::| :||.....|..|..:.||||.::  ...:.|.:.:|::.:|...:.:..:
  Fly   115 ------IFDSPVYGSKGLRTTAKITKGGYICEYAGELL--TVPEARSRLHDNEKLGLMNYILVLN 171

Human  3927 E----------VVDATMHGNAARFINHSCEPNCYSRVINIDGQ-KHIVIFAMRKIYRGEELTYDY 3980
            |          :||.:..||..|::||||||||:...:.||.. ..|.|||.|.|...|||.:.|
  Fly   172 EYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEELCFHY 236

Human  3981 --KFPIEDASNKLPCNCGAKKCRKFL 4004
              :...:..:....|.|||.||..|:
  Fly   237 GGEGQYKKMTGGKTCLCGASKCTGFM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KMT2AXP_011541131.1 zf-CXXC 1180..1227 CDD:251032
PHD1_KMT2A 1466..1512 CDD:277063
PHD2_KMT2A 1514..1563 CDD:277065
PHD3_KMT2A 1601..1660 CDD:277067
Bromo_ALL-1 1683..1813 CDD:99925
ePHD_KMT2A 1907..2019 CDD:277163
FYRN 2061..2107 CDD:283589
FYRC 3705..3788 CDD:197781 6/30 (20%)
SET <3861..4005 CDD:225491 47/158 (30%)
SET 3867..3987 CDD:214614 40/133 (30%)
PostSET 3989..4005 CDD:214703 7/16 (44%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838 25/115 (22%)
SET 111..239 CDD:214614 42/137 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.