DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7016 and Cited4

DIOPT Version :9

Sequence 1:NP_651301.1 Gene:CG7016 / 42968 FlyBaseID:FBgn0039238 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_062509.1 Gene:Cited4 / 56222 MGIID:1861694 Length:182 Species:Mus musculus


Alignment Length:100 Identity:35/100 - (35%)
Similarity:38/100 - (38%) Gaps:27/100 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GPGWNG-----GGGRGPPPRPGF----NGGGP----PPPRPGWNGGG---------PPP---PMP 193
            |||.:.     |...||||.||.    :.|.|    |.|.....|.|         |.|   |.|
Mouse    34 GPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAP 98

  Fly   194 GWNGGGPPP--PRPGWNGGGPPPPRPGWNGGMEQE 226
            ....|||.|  |.||.....||||.|...|.|:.|
Mouse    99 PAAAGGPSPLQPAPGAAASLPPPPPPPALGCMDTE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7016NP_651301.1 None
Cited4NP_062509.1 CITED 1..182 CDD:282356 34/99 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..129 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.