powered by:
Protein Alignment CG7016 and CG13615
DIOPT Version :9
Sequence 1: | NP_651301.1 |
Gene: | CG7016 / 42968 |
FlyBaseID: | FBgn0039238 |
Length: | 362 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651261.2 |
Gene: | CG13615 / 42916 |
FlyBaseID: | FBgn0039199 |
Length: | 331 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 28/72 - (38%) |
Gaps: | 32/72 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 PPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRLPDQP--- 237
|||| ||||.| ||||.| |||..||... |...||.||
Fly 114 PPPP--------PPPPPP------PPPPPP------PPPSPPGVPA-------NPVSLPPQPVIV 151
Fly 238 --DPNDP 242
:|.||
Fly 152 PLNPADP 158
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7016 | NP_651301.1 |
None |
CG13615 | NP_651261.2 |
DM4_12 |
225..320 |
CDD:214785 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.