DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7016 and CG13615

DIOPT Version :9

Sequence 1:NP_651301.1 Gene:CG7016 / 42968 FlyBaseID:FBgn0039238 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651261.2 Gene:CG13615 / 42916 FlyBaseID:FBgn0039199 Length:331 Species:Drosophila melanogaster


Alignment Length:72 Identity:27/72 - (37%)
Similarity:28/72 - (38%) Gaps:32/72 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRLPDQP--- 237
            ||||        ||||.|      ||||.|      |||..||...       |...||.||   
  Fly   114 PPPP--------PPPPPP------PPPPPP------PPPSPPGVPA-------NPVSLPPQPVIV 151

  Fly   238 --DPNDP 242
              :|.||
  Fly   152 PLNPADP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7016NP_651301.1 None
CG13615NP_651261.2 DM4_12 225..320 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.