DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7016 and F14F7.5

DIOPT Version :9

Sequence 1:NP_651301.1 Gene:CG7016 / 42968 FlyBaseID:FBgn0039238 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001293623.1 Gene:F14F7.5 / 176726 WormBaseID:WBGene00008812 Length:917 Species:Caenorhabditis elegans


Alignment Length:97 Identity:24/97 - (24%)
Similarity:34/97 - (35%) Gaps:31/97 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PQTPIPGPIFPTTTPKPEPTFPTIQPRPTAQPTKDTLIIGTNRPPLVPPHNPDPPTPTFPTWIVP 320
            |.|.|| |..|.::|.|....|..||:|                   .|....||.|:.|:....
 Worm   777 PTTTIP-PATPLSSPAPSNQSPPSQPQP-------------------GPRGSSPPAPSAPSAPET 821

  Fly   321 EPLPKPLDELSENRAIIFPSSSKYIHVPNPEV 352
            :.....|.:|:::.|           .|.|||
 Worm   822 DTNSLALVDLTDSPA-----------DPTPEV 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7016NP_651301.1 None
F14F7.5NP_001293623.1 WSN 55..123 CDD:197734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.