DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13640 and CG13639

DIOPT Version :10

Sequence 1:NP_651300.1 Gene:CG13640 / 42967 FlyBaseID:FBgn0039237 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001247299.1 Gene:CG13639 / 12798257 FlyBaseID:FBgn0265266 Length:69 Species:Drosophila melanogaster


Alignment Length:39 Identity:18/39 - (46%)
Similarity:24/39 - (61%) Gaps:1/39 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GRKPSGNRKGRTYSDIRRVINPDPYIGPGGSRFLPRTPY 127
            |...:..|.||:|:||.||:||:.|..| |||..|..|:
  Fly    28 GYHQTPKRDGRSYTDIARVVNPNQYAFP-GSRIYPGQPF 65

Return to query results.
Submit another query.