DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ACA7

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:259 Identity:76/259 - (29%)
Similarity:113/259 - (43%) Gaps:65/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVAR----SFAPINSGTRSHFG-------FNYDKQGR-----------DWNVKC--GERQSPI 41
            :|.||.    :...|:|...|| |       |||.|...           :|.: |  ||.||||
plant    10 IFFVALFSIFTIVSISSAASSH-GEVEDEREFNYKKNDEKGPERWGELKPEWEM-CGKGEMQSPI 72

  Fly    42 ALWSCNAITCNVPKLKFLN--YHKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQVFE 104
            .|  .|.....|..|..||  |:.|   ..::.|.|..:::   |..||:.   .|...|.: :|
plant    73 DL--MNERVNIVSHLGRLNRDYNPS---NATLKNRGHDIML---KFEDGAG---TIKINGFE-YE 125

  Fly   105 ADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPN 169
            ..|||:|      ..|||.::|..:..|:|:||:..:.:......|...|.|  ..|||:||   
plant   126 LQQLHWH------SPSEHTINGRRFALELHMVHEGRNRRMAVVTVLYKIGRA--DTFIRSLE--- 179

  Fly   170 IETPAMNMICKQVSSITKLDDSCPLEDSMALQD-LFASIDSQKYFTYQGSLTTPPCAEAVIWFV 232
                      |::..|.:::::   |.::.:.| ....|.|:||:.|.||||||||.:.|.|.|
plant   180 ----------KELEGIAEMEEA---EKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 62/201 (31%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 64/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.