DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ACA5

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_172285.2 Gene:ACA5 / 837324 AraportID:AT1G08065 Length:277 Species:Arabidopsis thaliana


Alignment Length:293 Identity:72/293 - (24%)
Similarity:122/293 - (41%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFAPINSGTRSHFGFNYDKQGR-----------DWNVKCGE--RQSPIALWSCNAITCNVPKLKF 58
            |.:|.:........|||:|:|.           :| ..||:  .||||.|.....:..:     .
plant    21 SSSPDHGEVEDETQFNYEKKGEKGPENWGRLKPEW-AMCGKGNMQSPIDLTDKRVLIDH-----N 79

  Fly    59 LNYHKS--LCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSE 121
            |.|.:|  |....::.|.|..::|:.    :|....|.|:..|.: ::..|:|:|      ..||
plant    80 LGYLRSQYLPSNATIKNRGHDIMMKF----EGGNAGLGITINGTE-YKLQQIHWH------SPSE 133

  Fly   122 HCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSIT 186
            |.|:|..:..|.|:||::...::           ||:|.|.: |..|:.....:....|:::   
plant   134 HTLNGKRFVLEEHMVHQSKDGRN-----------AVVAFFYK-LGKPDYFLLTLERYLKRIT--- 183

  Fly   187 KLDDSCPLEDSMALQDLFASI-------DSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKEL- 243
                     |:...|:....:       :|:.|:.:.||||||||:|.|||       .:.||: 
plant   184 ---------DTHESQEFVEMVHPRTFGFESKHYYRFIGSLTTPPCSENVIW-------TISKEMR 232

  Fly   244 ---WKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
               .|....||.:...:..:..|.||..::|||
plant   233 TVTLKQLIMLRVTVHDQSNSNARPLQRKNERPV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 63/254 (25%)
ACA5NP_172285.2 PLN02179 9..231 CDD:177835 62/257 (24%)
alpha_CA_prokaryotic_like 44..265 CDD:239398 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.